Size 50 μg
Catalog Number: AUB-001
Product Information
Product Name Ac-PTEN(Ub)-NH₂
Sequence MQIFVKTLGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Formation Appearance White powder, lyophilized. Protein content determined by UV absorbance of 280 nm
Purity >95% by reverse-phase HPLC
Preparation and Storage
It is recommended that unopened vials are stored at -20 °C to -70 °C for periods of up to 12 months. Avoid repeat freeze-thaw cycles. Centrifuge vials prior to opening. Reconstitute in water or suitable buffer. If required, DMSO can be added to aid solubility
Delivery
Shipped within 1 week of ordering
Ubiquitylation is the attachment of the C-terminal glycine of the 76 amino acid protein ubiquitin (Ub) to the -amino group of a lysine in the target protein via an isopeptide bond