Product Information
Product Name h-MCP-2 (AF647®), synthetic
Synonyms CCL8 (Alexa647®) human, Small-inducible cytokine A8, Monocyte chemoattractant protein 2 (Alexa647®)
Swiss Prot Accession No. P80075
Sequence pyrPDSVSIPITCCFNVINRKIPIQRLESYTR ITNIQCPKEAVIFKTKRGKEVCADPKERWV RDSMKHLDQIFQNLK(Linker-Cys-AF647®)P
Modifications AF647® incorporated at indicated position in a molar ratio of dye:peptide of 1:1. Linker used is 8-amino-3,6-dioxaoctanoic acid.
Determined Mass 9.3 kDa
Formation Appearance Blue powder lyophilized from water/acetonitrile/ TFA to generate the TFA salt form. Peptide content determined by UV analysis at 280nm.
Purity >95% area/area at 214nm
Preparation and Storage
It is recommended that unopened vials are stored at -20 °C to -70 °C for periods of up to 18 months. Avoid repeat freeze-thaw cycles. It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 μmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.
Delivery
Shipped within 1 week of ordering
Catalog No. CN-18_1mg
Catalog No. CB-18_10ug
Catalog No. CB-18_100ug
Catalog No. CN-18_20ug
Catalog No. CN-18_100ug