h-MCP-2 (Biotin), synthetic

Size 10ug

Catalog Number: CB-18_10ug

Size
10ug
£620.00

Product Information

Product Name h-MCP-2 (Biotin), synthetic

Synonyms Synonyms: CCL8 (Biotin) human, Small-inducible cytokine A8, Monocyte chemoattractant protein 2

Swiss Prot Accession No. P80075

Sequence Pyr-PDSVSIPITCCFNVINRKIPIQRLESYTR ITNIQCPKEAVIFKTKRGKEVCADPKERWV RDSMKHLDQIFQNLK(Linker-Biotin)P

Modifications Biotin incorporated at indicated position in a molar ratio of biotin:peptide of 1:1. Linker used is 8-amino-3,6-dioxaoctanoic acid.

Determined Mass 9.3 kDa

Formation Appearance White powder lyophilized from water/acetonitrile/ TFA to generate the TFA salt form. Peptide content determined by UV analysis at 280nm

Purity >95% area/area at 214nm

Preparation and Storage

It is recommended that unopened vials are stored at -20 °C to -70 °C for periods of up to 18 months. Avoid repeat freeze-thaw cycles. It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 μmol.L-1. Stock solutions with up to 30% DMSO/water can also be prepared.

Delivery

Shipped within 1 week of ordering


You may also be interested in

Catalog No. CN-18_1mg

£1,625.00

Catalog No. CAF-18_100ug

£3,785.00

Catalog No. CAF-18_10ug

£770.00

Catalog No. CN-18_100ug

£545.00

Catalog No. CN-18_20ug

£220.00