5’-TAMRA-K(Ub)-NH₂
Size 100ug
Catalog Number: AUB-101
US$375.00
Product Information
Product Name 5’-TAMRA-K(Ub)-NH₂
Sequence MQIFVKTLGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Formation Appearance Magenta powder, lyophilized. Protein content determined by UV absorbance of 5’-TAMRA at 550 Nm
Purity >90% by SDS-PAGE
Preparation and Storage
It is recommended that unopened vials are stored at -20 °C to -70 °C for periods of up to 12 months. Avoid repeat freeze-thaw cycles. Centrifuge vials prior to opening. Reconstitute in DMSO (100 - 200 M) and dilute into assay buffer
Delivery
Shipped within 1 week of ordering
Ubiquitylation is the attachment of the C-terminal glycine of the 76 amino acid protein ubiquitin (Ub) to the -amino group of a lysine in the target protein via an isopeptide bond
