5’-TAMRA-K(Ub)-NH₂

Size 100ug

Catalog Number: AUB-101

£235.00

Product Information

Product Name 5’-TAMRA-K(Ub)-NH₂

Sequence MQIFVKTLGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Formation Appearance Magenta powder, lyophilized. Protein content determined by UV absorbance of 5’-TAMRA at 550 Nm

Purity >90% by SDS-PAGE

Preparation and Storage

It is recommended that unopened vials are stored at -20 °C to -70 °C for periods of up to 12 months. Avoid repeat freeze-thaw cycles. Centrifuge vials prior to opening. Reconstitute in DMSO (100 - 200 M) and dilute into assay buffer

Delivery

Shipped within 1 week of ordering

Ubiquitylation is the attachment of the C-terminal glycine of the 76 amino acid protein ubiquitin (Ub) to the -amino group of a lysine in the target protein via an isopeptide bond